'

ПЕРВЫЙ ОПЫТ УЧАСТИЯ В ШТРИХ-КОДИРОВАНИИ ВИДОВ РЫБ РОССИИ НА ОСНОВЕ ПЕРВИЧНОЙ ПОСЛЕДОВАТЕЛЬНОСТИ ГЕНА СО-1

Понравилась презентация – покажи это...





Слайд 0

ПЕРВЫЙ ОПЫТ УЧАСТИЯ В ШТРИХ-КОДИРОВАНИИ ВИДОВ РЫБ РОССИИ НА ОСНОВЕ ПЕРВИЧНОЙ ПОСЛЕДОВАТЕЛЬНОСТИ ГЕНА СО-1 Картавцев Ю.Ф., Шарина С.Н., Чичвархин А.Ю., Соколовский А.С., Баланов А.А., Винников К.А., Иванков В.Н. Институт биологии моря имени А.В. Жирмунского Дальневосточного отделения Российской академии наук, Владивосток 690041; e-mail: Kartavtsev_yu48@hotmail.com


Слайд 1

Схема работы: Отлов рыб Запись в базу данных Определение видов Взятие образцов скелетных мышц, Фиксация в спирте Фотографирование видов рыб Выделение ДНК Амплификация Электрофорез Цикло- секвенирование Извлечение дополнительных последовательностей из GenBank Выравнивание Последовательностей, Удаление гэпов Регистрация своих последовательностей В GenBank Построение филогенетических деревьев Редактирование полученных последовательностей Секвенирование


Слайд 2

Некоторые из объектов Рис. 1 Внешний вид (А) полосатой камбалы (Liopseta pinifasciata) и (Б) темной камбалы (Pseudopleuronectes obcurus) А Б


Слайд 3

Фрагмент таблицы базы данных (в таблице указывается номер пробы (образца), название вида, систематика вида, кем данный вид определен, где собран, кем и когда).


Слайд 4

Тотальную ДНК выделяли из скелетных мышц обычной хлороформ-фенольной методикой с осаждением ДНК спиртом. Полученную ДНК амплифицировали с помощью ПЦР-методики в прямом и обратном направлении с использованием праймеров F1 – R1 и F2 – R2, затем продукты ПЦР подвергали электрофорезу в 1% агарозном геле и окрашивали бромистым этидием после чего просматривали в УФ-свете, где было видно что длина амплифицированной последовательности (т.е. длина гена СО-1) составляет примерно 700п.н. (для определения длины гена использовали маркер (1100+100)).


Слайд 5

Праймеры используемые для ПЦР-реакции (Ward et al., 2005) FishF1-50TCAACCAACCACAAAGACATTGGCAC30, FishF2-50TCGACTAATCATAAAGATATCGGCAC30, FishR1-50TAGACTTCTGGGTGGCCAAAGAATCA30, FishR2-50ACTTCAGGGTGACCGAAGAATCAGAA30.


Слайд 6

Вид продуктов ПЦР-реакции в агарозном геле после электрофореза. Цифрами 2-23 обозначены номера проб, 1 – маркер, стрелкой обозначен старт электрофореза. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23


Слайд 7

Амплификация Реакционная смесь на одну пробу (25µl) для ПЦР включала: дистиллированная вода - 17,4 µl; Ex-Tag буфер – 2,5; смесь dNTP – 2,0; праймер F1 (20pmol/ µl ) – 1,0; праймер R1 (20pmol/ µl ) – 1,0; Ex-Tag полимераза – 0,5; образец ДНК – 1,0 30 циклов Циклосеквенирование Циклосеквенирование проводили с использованием реагентов фирмы Amersham (Amersham, DYEnamic ET Terminator Cycle Sequencing Kit) 30 циклов


Слайд 8

Такой вид имеет последовательность после секвенирования, использовалась модель секвенатора АBI-3100 (Applied Biosistems, USA)


Слайд 9

Отредактированная последовательность одного образца.


Слайд 10

Окно GenBank


Слайд 11

Рис. 8 Окна установления параметров для выравнивания (А) штрафы для первого выравнивания, (Б) штрафы для второго выравнивания Б А


Слайд 12

Выровненные последовательности гена Со-1 взятые из Генного банка вместе со своими последовательностями


Слайд 13

Значения средних р-расстояний по гену Со-1 на четырех различных филогенетических уровнях (средняя+SE) : 1. Внутривидовом 0.09+0.06% 2. Внутриродовом 0.97+1.87% 3. Внутрисемейственном 11.98+0.63% 4. Внутриотрядном 20.09+0.17%


Слайд 14

Укорененное дерево построенное на основе метода ближайшего соседства (NJ) показывающее филогенетические взаимосвязи на основе нуклеотидных последовательностей гена Co-1 для 19 проанализированных видов камбал (Pleuronectiformes) и двух внешних таксонов (out-group). В узлах показана bootstrap поддержка n=1000. Древо построено на основе модели Kumara 2 parametres и укорененное по двум внешним таксонам: Окунеообразные (Perciformes). Отрезки снизу показывают масштаб для длин ветвей.


Слайд 15

Укорененное Байесовское консенсусное (50%) древо показывающее филогенетические взаимосвязи на основе нуклеотидных последовательностей гена Co-1 для 13 проанализированных видов камбал (Pleuronectiformes) и двух внешних таксонов (out-group). В узлах показаны частоты (вероятности) в n=106 модельных повторностей. Древо построено на основе модели Тамуры-Нея (TrN+I+G) и укорененное по двум внешним таксонам: Окунеообразные, Perciformes. Отрезки снизу показывают масштаб для длин ветвей.


Слайд 16

Полученные нуклеотидные последовательности были зарегистрированы в GenBank под номерами: EF643448 1K-F2 - Liopseta pinifasciata EF643449 2K-F1 - Liopseta pinifasciata EF643450 13-R1 - Liopseta pinifasciata EF643451 5K-F1 - Hippoglossoides dubius EF643452 7K-F1 - Pseudopleuronectes hersensteini


Слайд 17

LOCUS       bankit916597             613 bp    DNA     circular     01-JUN-2007 DEFINITION  Flounder mtDNA Co-1 sequence, coding for cytocrome oxidase subunit             1. ACCESSION   916597 VERSION KEYWORDS    . SOURCE      mitochondrion Pseudopleuronectes hersensteini (Jordan & Snyder,             1901)   ORGANISM  Pseudopleuronectes hersensteini (Jordan & Snyder, 1901)             Unclassified. REFERENCE   1  (bases 1 to 613)   AUTHORS   Scharina,S., Kartavtsev,Y., Goto,T., Chichvarkhin,A., Hanzawa,N.,             Sokolovsky,A., Balanov,A., Vinnikov,K. and Ivankov,V.   TITLE     BARCODING OF FAR EASTERN FLATFISH SPECIES OF RUSSIA ON CYTOCHROME             OXIDASE 1 AND CYTOCHROME B GENE SEQUENCE DATA   JOURNAL   Unpublished REFERENCE   2  (bases 1 to 613)   AUTHORS   Kartavtsev,Y., Scharina,S., Goto,T. and Chichvarkhin,A.   TITLE     Direct Submission   JOURNAL   Submitted (01-JUN-2007) Group of Genetic Resources, Institute of             Marine Biology, Paltchevski 17, Vladivostok, Primorye 690041,             Russia COMMENT     Bankit Comment: Peter the Great Bay, East Sea, August, 2006             sharina-svetlana@rambler.ru. FEATURES             Location/Qualifiers      source          1..613                      /organism="Pseudopleuronectes hersensteini (Jordan &                      Snyder, 1901)"                      /organelle="mitochondrion"                      /mol_type="genomic DNA"                      /PCR_primers="fwd_name: FishF1, fwd_seq:                      tcaaccaaccacaaagacattggcac, rev_name: FishR1, rev_seq:                      tagacttctgggtggccaaagaatca"                      /genotype="7K-F1"                      /note="Pisces, Pleuronectiformes, Pleuronectidae,                      Pseudopleuronectes hersensteini"      gene            11..613                      /gene="CO-1"      CDS             11..613                      /gene="CO-1"                      /codon_start=1                      /transl_table=2                      /protein_id="PROT_1_bankit916597"                      /translation="MSLGTGLSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMISL**                      YQLWLEGSETDYPLMIGAPEYGLPSNKNMSFWLLPPSFLLLLASSGWSRGGN*WTVTP                      H*LELAHAGAS*THHFSLHLAGISQF*GQSTLSPHMNETNSSTMYQIPYLFGPYNYRC                      PSSPFPPVLAAGITCYWQTAT*TQPSLTLR*GWPILYLLG" BASE COUNT      147 a    172 c    124 g    170 t ORIGIN               1 tgttgtttgt gtgagcctgg ggacaggcct aagtctgctc attcgagcag agctaagcca        61 acctggggct ctcctgggag acgaccaaat ttataacgta atcgtcaccg cacacgcctt       121 tgtaataatt tctttatagt aataccaatt atgattggag ggttcggaaa ctgactatcc       181 attaataatt ggggcccccg aatatggcct tccctcgaat aaaaacatga gcttctgact       241 tctaccccca tccttcctcc ttcttttggc ctcttcaggg tgaagccggg gcgggaacag       301 gtgaaccgtt accccccact agctggaact agcacacgcc ggagcatcgt agactcacca       361 tttctctctt caccttgccg gaatttctca attctagggg caatcaactt tatcaccaca       421 tataaatgaa accaacagca gtactatgta ccaaatcccc tatttgtttg ggccgtataa       481 ttaccgctgt ccttcttctc ctttccctcc ggttctagcc gctggcatta catgctactg       541 acagaccgca acctaaacac aaccttcttt gaccctgcgg agggggtgac ccattcttta       601 cctgttgggt taa // Так выглядит запись одной из последовательностей в GenBank:


Слайд 18

СПАСИБО ЗА ВНИМАНИЕ!


Слайд 19


×

HTML:





Ссылка: