'

BLAST:

Понравилась презентация – покажи это...





Слайд 0

BLAST: Basic Local Alignment Search Tool


Слайд 1

BLAST – алгоритм для нахождения участков локального сходства между последовательностями. Алгоритм сравнивает входную последовательность с последовательностями в базе данных, ищет сходные последовательности в базе данных и оценивает статистическую значимость находок.


Слайд 2

Protein BLAST: поиск аминокислотной последовательности в базе данных белков Алгоритмы blastp psi-blast phi-blast Здесь описан интерфейс, установленный на «родине» BLAST: National Center for Biotechnology Information (NCBI) в США, http://blast.ncbi.nlm.nih.gov/


Слайд 3

вводим последовательность база данных организм (если надо ограничить) дополнительные параметры http://blast.ncbi.nlm.nih.gov/ > protein blast


Слайд 4

Параметры сервиса максимальный размер выдачи порог на E-value параметры выравнивания борьба с «участками малой сложности»


Слайд 5

Участок малой сложности Ищем: белок P02929 если отключить “Compositional adjustments” и фильтр, то одной из находок (18-ой от начала) будет следующее: в исходном белке имеется участок, содержащий очень много пролина и глутаминовой кислоты Данное выравнивание не свидетельствует о гомологии, несмотря на хорошее значение E-value (10-9)


Слайд 6

выбираем formatting options подтверждаем выбор Переход к текстовому виду Чтобы увидеть выдачу самой программы (а не его обработку интерфейсом), можно поступить так:


Слайд 7

Что выдает BLAST? Набор последовательностей, сходных с входной последовательностью для каждой находки приведены E-value (“Expect”), Bit Score и Score процент идентичности, сходства (Positives) и пробелов (Gaps) в выравнивании информация о найденной последовательности


Слайд 8

Length=129 Score = 78.6 bits (192), Expect = 9e-15, Method: Compositional matrix adjust. Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%) Query 17 YRLEEVQKHNNSQSTWIIVHHRIYDITKFLDEHPGGEEVLREQAGGDATENFEDVGHSTD 76 Y EEV +H W+I++ ++Y+I+ ++DEHPGGEEV+ + AG DATE F+D+GHS + Sbjct 11 YTHEEVAQHTTHDDLWVILNGKVYNISNYIDEHPGGEEVILDCAGTDATEAFDDIGHSDE 70 Query 77 ARALSETFIIGEL 89 A + E IG L Sbjct 71 AHEILEKLYIGNL 83 Выравнивание, выданное BLAST Вес в битах Вес E-value Число совпадений Длина выравнивания Длина найденного белка


Слайд 9

E-value – ожидаемое количество случайных находок с таким же и лучшим Score (в той же базе данных, с теми же параметрами): E-value=Kmn·e-?S S – Score (вес) m – длина исходной последовательности n – размер базы данных (суммарная длина всех последовательностей) K и ? - параметры     Чем меньше E-value, тем больше значимость находки. Bit score (вес в битах) Выражение E-value через биты


×

HTML:





Ссылка: