'

МАСС-СПЕКТРОМЕТРИЯ В ПРОТЕОМНЫХ ИССЛЕДОВАНИЯХ

Понравилась презентация – покажи это...





Слайд 0

МАСС-СПЕКТРОМЕТРИЯ В ПРОТЕОМНЫХ ИССЛЕДОВАНИЯХ Марина Васильевна Серебрякова Лаборатория протеомного анализа ФГУ НИИ ФХМ г.Москва www.pynny.ru Часть 1: Масс-спектрометрия


Слайд 1

Белки и пептиды Моноизотопные массы аминокислотных остатков ADLKQLMDNEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDCAGFGKGENAKKFLRTDEKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAYLTPLPQPNRGLAFFVGYGVTLSMAYRLLRSRLYL (Глутатион-трансфераза человека) пептидная связь аминокислотный остаток


Слайд 2

SAPASTTQPIGSTTSTTTKTAGATPATASGLFTIPDGDFFSTARAIVASNAVATNEDLSKIEAIWKDMKVPTDTMAQAAWDLVRHCADVGSSAQTEMIDTGPYSNGISRARLAAAIKEVCTLRQFCMKYAPVVWNWMLTNNSPPANWQAQGFKPEHKFAAFDFFNGVTNPAAIMPKEGLIRPPSEAEMNAAQTAAFVKITKARAQSNDFASLDAAVTRGRITGTTTAEAVVTLPPP (Белок оболочки Х-вируса картофеля) Пептидный фингерпринт Num From-To MH+ HPLC pI Sequence 1 1- 19 1836.92 14,27 9,85 SAPASTTQPIGSTTSTTTK 1 1- 19 1878.93 14,27 9,85 SAPASTTQPIGSTTSTTTK 2 20- 44 2472.20 24,79 3,92 TAGATPA..PDGDFFSTAR 3 45- 60 1602.83 12,87 4,11 AIVASNAVATNEDLSK 4 61- 66 759.44 19,33 6,99 IEAIWK 5 67- 69 393.18 4,27 6,99 DMK 6 70- 84 1673.83 19,51 3,92 VPTDTMAQAAWDLVR 7 85-109 2595.13 22,48 4,34 HCADVGSS..GPYSNGISR 8 110-111 246.16 1,78 11,20 AR 9 112-117 586.39 12,82 10,10 LAAAIK 10 118-123 719.36 14,84 6,29 EVCTLR 11 124-128 655.28 17,08 8,68 QFCMK 12 129-157 3410.65 28,07 9,42 YAPVVWNWM..QGFKPEHK 13 158-176 2058.02 24,21 6,97 FAAFDFFNGVTNPAAIMPK 14 177-198 2330.18 20,92 4,60 EGLIRPPS..AAQTAAFVK 15 199-201 361.25 6,80 10,15 ITK 16 202-203 246.16 1,78 11,20 AR 17 204-218 1565.76 14,77 3,92 AQSNDFASLDAAVTR 18 219-220 232.14 2,11 11,15 GR 19 221-236 1567.86 17,90 3,15 ITGTTTAEAVVTLPPP Num From-To MH+ HPLC pI Sequence 1 1- 56 5430.68 29,08 4,35 SAPASTTQPI…IVASNAVATNE 1 1- 56 5472.69 29,08 4,35 SAPASTTQPI…IVASNAVATNE 2 57- 62 704.38 12,90 4,11 DLSKIE 3 63- 96 3730.75 28,42 4,58 AIWKDMKVPT..ADVGSSAQTE 4 97-118 2334.22 22,73 9,58 MIDTGPYSNGISRARLAAAIKE 5 119-155 4353.07 35,01 9,02 VCTLRQFCMKY…NWQAQGFKPE 6 156-177 2452.21 24,30 7,58 HKFAAFDFFNGVTNPAAIMPKE 7 178-185 868.49 16,16 7,04 GLIRPPSE 8 186-187 219.10 1,83 3,25 AE 9 188-228 4255.19 24,38 10,52 MNAAQTAAFV…RGRITGTTTAE 10 229-236 793.48 14,07 6,96 AVVTLPPP Трипсин ( /R,K) Стафилококковая протеаза V8 ( /E) Пептидный калькулятор GPMAW 4.04


Слайд 3

1 определение количества того или иного белка в образце 2 идентификация белка 3 уточнение первичной структуры 4 определение пост-трансляционных модификаций ПРЕДПОСЫЛКИ: Реализация программы Геномика – быстрое секвенирование ДНК, создание баз данных нуклеотидных последовательностей Развитие инструментальных методов – масс-спектрометрия белков и пептидов, сопряжение с методами разделения ПРОТЕОМИКА – совокупность высокотехнологичных методов изучения белков:


Слайд 4

Общий вопрос - что измеряется? Масс- спектрометрия – расчет молекулярной массы ионов по их поведению в электрических и/или магнитных полях Сила, действующая на ион массы m и заряда z в однородном электрическом поле: Сила, действующая на ион массы m, заряда z, скорости v в однородном магнитном поле: Примеры: Fq = zeE FL = ze[vxB] a = (z/m)eE a = (z/m)e[vxB] m/z МАСС-СПЕКТРОМЕТРИЯ БЕЛКОВ И ПЕПТИДОВ


Слайд 5

Источник ионов Система разделения ионов Детектор Общая схема масс-спектрометра MALDI ESI Времяпролетные (TOF) Квадрупольные (Q) Ионные ловушки (IT) Ионно-циклотронного резонанса (ICR-FT) Микроканальные пластины (MCP) Диноды Магнит (ICR-FT) Положительные: - захват протона либо другого катиона (Na, K); - потеря электрона (катион-радикал). Отрицательные: - утрата протона; - захват электрона. Типы ионов


Слайд 6

ESI – электрораспыление и ионизация Растворители: вода, ацетонитрил, метанол Анализируемое вещество подается в растворе через капилляр с поданым на него напряжением. несколько последовательных «упариваний-взрывов» микрокапель В результате получаются многозарядные газофазные ионы, захватившие на себя разное количество протонов, вплоть до максимально возможного. ИСТОЧНИКИ ИОНОВ


Слайд 7

МАТРИЦА: * Поглощает энегрию лазерного излучения, “вскипая”, увлекает в газовую фазу молекулы анализируемого вещества * Способствует ионизации Матрицы для УФ лазера (336нм) Лазер: 2нс, 50-300 мкДж/имп , 50мкм Анализируемое вещество (раствор 10-4 -10-8 М, <1 мкл) смешивается с матрицей (раствор 10-1 -10-2 М, <1 мкл), высушивается на подложке, образуя кристаллоиды MALDI - matrix assisted laser desorption / ionization лазерная десорбция и ионизация в присутствии вспомогательного вещества - матрицы


Слайд 8

MLLTQVQTYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK Пример MALDI масс-спектра: триптический гидролизат фрагмента белка М1 вируса гриппа


Слайд 9

Точный механизм MALDI ионизации неизвестен, однако в результате образуются, как правило, однозарядные ионы, захватившие протон либо иной катион. MALDI : типы положительных ионов и вид спектра


Слайд 10

Пептид массой 2000 Д содержит ~ 100 углеродов в нем с вероятностью ~ 30% не встретится 13С, с вероятностью ~ 50% встретится один 13С, с вероятностью ~ 20% встретится два 13С. NB: в масс-спектре детектируется 103 – 106 молекул аналита. Этого достаточно для наблюдения изотопного рапределения. Моноизотопная масса – масса пептида, не содержащего ни одного13С вид MALDI масс-спектра вид ESI масс-спектра моноизотопнная масса средняя (average) масса Естественное изотопное распределение в белках и пептидах


Слайд 11

* Оба метода ионизации требуют высокой химической чистоты анализируемого вещества. * Диапазон концентрации аналита при ESI и MALDI 10-3 – 10-7 M. * Поскольку разные вещества (например, пептиды) обладают разной способностью к ионизации (захвату протона либо другого катиона), то невозможно делать выводы о количественном соотношении компонентов сложной смеси на основании высот пиков в спектре. При ESI образуется непрерывный поток ионов, при MALDI - сильно ограниченный во времени (до 10нс) пакет ионов. При ESI анализу подлежит более 10 фемтомолей вещества, при MALDI - более 1 фемтомоля вещества. При ESI образуются ионы m/z 0-5000, возможно измерение белков до ~50 000 Да. При MALDI возможно измерение белков до ~200 000 Да, диапазон измеряемых масс ограничен снизу до ~500 Да из-за присутсвия с спектрах пиков матрицы. ESI является более “мягким” способом ионизации, чем MALDI. Замечания о ESI и MALDI:


Слайд 12

Квадрупольный анализатор Ионная ловушка Магнитный анализатор Времяпролетный масс-анализатор СИСТЕМЫ РАЗДЕЛЕНИЯ ИОНОВ


Слайд 13

Микроканальные пластины При MALDI существует разброс по энергиям, приводящий к уширению пиков. Энергия ускорения 20 кэВ и длина пути 1м При энергии ускорения 20 кэВ разброс в 100эВ составляет 0.5%. Так пик пептида м.в. 1000Д имел бы ширину на половине высоте около 2 Да ! MALDI-времяпролетный масс-спектрометр с MCP детектором


Слайд 14

Использование отражающего напряжения (рефлектрона Мамырина) Использование «отсрочки экстракции» вакуум Уменьшение стартового разброса ионов – повышение разрешения MALDI-TOF-MS


Слайд 15

Разрешение до 30 000, точность до 0.002% (=20ppm). Разрешение и точность MALDI-TOF-MS


Слайд 16

Когда ион, захвативший избыток энергии в процессе MALDI, распадается в области свободного дрейфа, фрагменты имеют ту же скорость, что и их родительский ион, а энергию - меньшую (~ m) Распад ионов в процессе MALDI


Слайд 17

для адекватного отражения дочерних ионов: U1ref/U0ref = m1/m0 набор масс-спектров с разным U рефлектрона компьютерно “сшиваются” в один спектр PSD получается один спектр фрагментации TOF-TOF точность измерения масс фрагментов 0.02-0.1% PSD (post source decay) и TOF-TOF детекция распада ионов во время свободного дрейфа


Слайд 18

На верхний и нижний электроды подано постоянное положительное напряжение. На короткое время отталкивающее напряжение с верхнего электрода снимается, позволяя пакету ионов влететь в ловушку. На центральном электроде -быстропеременное напряжение, которое заставляет ионы всех m/z двигаться со своими частотами по своим орбитам. Затем, на экстрагирующие линзы подается осцилируещее напряжение, последовательно вытягивающее ионы согласно их m/z. Характеристиками ловушки являются: ёмкость (верхнее значение разделяемых m/z ) до 4000, разрешение до 0.2 Да по диапазону, точность до 0.01% (=100ppm) для родительских ионов и фрагментов. Ионные ловушки позволяют, варьируя напряжения, оставлять в ловушке определенные ионы и получать спектры их фрагментов. При этом возможен ряд последовательных фрагментаций иона. Ионная ловушка хорошо сочетается с жидкостным хроматографом. ESI – ионная ловушка с МСР детектором


Слайд 19

Сочетает хорошее разрешение времяпролетного масс-спектрометра с возможностью хорошего выделения (включением квадруполя) определенных ионов для получения спектров фрагментации. На электроды квадруполя подается переменное напряжение, позволяющее пролетать только резонансным ионам. Напуск инертного газа приводит к столкновительной фрагментации ионов. точность 0.01-0.03% для родительских ионов и фрагментов «Гибридные» приборы: ESI – квадруполь – ортогональный времяпролетный МС


Слайд 20

Ионы «запираются» в мощный (7-14 тесла) секторный сверхпроводящий магнит, где вращаются под действием силы Лоренца с частотой, зависящей от m/z. Два сектора магнита используются для снятия токов, наведенных пролетающими мимо них ионами. Сложный сигнал от ионов разных m/z подлежит разложению по частотам (Фурье-преобразованию). Характеристики ICR-FT : разрешение до 10 000 000, точность до 0.0001% (=1ppm). ESI - масс-спектрометры ионно-циклотронног резонанса с последующим Фурье- преобразованием (ICR-FT)


Слайд 21

Сравнение характеристик приборов


Слайд 22

Cовременный масс-спектрометр основан на работе, сделанной сэром Дж. Томсоном в Кэвендишевской лаборатории Кембриджского университета. Исследования Томсона, приведшие к открытию электрона в 1897 году, также привели к созданию первого масс-спектрометра, построенного им для изучения влияния электрического и магнитного полей на ионы, генерируемые в остаточном газе на катоде рентгеновской трубки. В 1906 году Томсон получил Нобелевскую премию по физике за "Выдающиеся заслуги в теоретическом и экспериментальном изучении электропроводимости газов". К концу Первой мировой войны работы Френсиса Астона и Артура Демпстера привели к значительному улучшению точности и воспроизводимости измерений на масс-спектрометрах. Позднее Альфред Нир воплотил эти достижения вместе со значительным продвижением в вакуумной технике и электронике в конструкцию масс-спектрометра, значительно сократив его размеры. Еще раньше, в 1946 году, Уильям Стивенс предложил концепцию времяпролетных анализаторов. В середине 1950-ых годов Вольфганг Пол разработал квадрупольный масс-анализатор. Другой разработкой Пола было создание квадрупольной ионной ловушки, специально предназначенной для захвата и измерения масс ионов. За свои инновационные работы Вольфганг Пол получил в 1989 году Нобелевскую премию по физике. В 1950-е годы впервые были соединены газовый хроматограф и масс-спектрометр (Голке, Маклаферти и Рихаге). Затем появились новые методы ионизации - бомбардировка быстрыми атомами (Барбер), химическая ионизация (Тальрозе, Филд, Мансон), полевая десорбция/ ионизация (Беки), MALDI (Танака, Карас, Хилленкампф), ESI (Доул, Фенн), ионизация в инуктивно-связанной плазме (Фассел). Были разработаны масс-спектрометры ионно-циклотронного резонанса (Хиппл) и, затем, с Фурье-преобразованием сигнала (Комиссаров, Маршалл), тройные квадрупольные тандемные масс-спектрометры (Йоуст, Энке). Историческая справка:


×

HTML:





Ссылка: