'

Белорусский государственный университет, биологический факультет, кафедра генетики, 220030 Беларусь, Минск, Пр. Независимости, 4.

Понравилась презентация – покажи это...





Слайд 0

ПЛАЗМИДЫ СЕМЕЙСТВА pBS72 КАК ОСНОВА ДЛЯ СОЗДАНИЯ ВЕКТОРНЫХ СИСТЕМ Белорусский государственный университет, биологический факультет, кафедра генетики, 220030 Беларусь, Минск, Пр. Независимости, 4. Чалей В.А., Лагодич А.В., Карпиевич М.Н., Титок М.А., E-mail: LagodichAV@bsu.by Повсеместно распространенные в природной среде обитания бактерии Bacillus subtilits способны утилизировать широкий спектр органических и неорганических субстратов, продуцировать во внешнюю среду биологически активные соединения (ферменты, антибиотики, стимуляторы роста растений), являются весьма востребованными объектами биотехнологических отраслей производства, и первыми кандидатурами при разработке штаммов-продуцентов. Наличие полной нуклеотидной последовательности генома этих микроорганизмов позволяет целенаправленно изменять их свойства для биотехнологического использования. Одним из подходов, обеспечивающих детальное изучение регуляции экспрессии генов и улучшение практических свойств штаммов-продуцентов, является применение для этих целей векторных молекул, несущих чужеродный генетический материал. При этом в качестве векторов, как правило, используются внехромосомные генетические элементы, наиболее перспективными из которых являются плазмиды, реплицирующиеся согласно механизма тета-типа. Однако в настоящее время у бактерий B. subtilis наиболее изученными являются плазмиды, реплицирующиеся в соответствии с механизмом «катящегося кольца», в то время как плазмиды тета-типа практически не описаны. Однако именно плазмиды тета-типа являются наиболее перспективными в плане создания на их основе векторов для молекулярного клонирования. Поиск и характеризация плазмид среди природных штаммов этих микроорганизмов позволяет не только исследовать закономерности распространения репликонов определенного типа, но и выявить внехромосомные генетические элементы, обладающие новыми свойствами. Внехромосомные генетические элементы могут служить основой при конструировании векторных молекул. Векторные системы широко применяемые для молекулярного клонирования в клетках грамположительных бактерий основаны на использовании RCR-плазмид. Недостатком этих векторов является структурная и сегрегационная нестабильность, которая определена самим механизмом репликациии. При репликации плазмид RCR-типа могут формироваться высоко-молекулярные линейные однонитевые структуры, представленные множественными копиями плазмидного генома (the HMW-forms). Образование таких структур и наличие в составе клонированной последовательности chi sites (5'-GCTGGTGG-3') существенно увеличивает вероятность рекомбинации между плазмидной и хромосомной ДНК, что и ведет к структурной и сегрегационной нестабильности. В отличии от RCR-плазмид плазмиды ?-типа не формируют HMW-структур и, следовательно, лищены указанных недостатков. В связи с вышеизложенным наиболее предпочтительными элементами являются плазмиды, реплицирующиеся по механизму ?-типа. За исключением pLS20, плазмиды такого типа у B. subtilis не описанны, а данные об использовании pLS20 для конструирования векторов отсутствуют. Настоящая работа посвящена изучению молекулярно-генетической организации плазмид ?-типа бактерий B. subtilis, выделенных из различных природных источников на территории Беларуси, и их использованию при создании векторов для молекулярного клонирования в клетках грамотрицательных (Escherichia coli) и грамположительных (Bacillus subtilis) бактерий. Использование метода щелочного лизиса с последующим электрофоретическим анализом выделенной ДНК в 20 % случаев позволило выявить внехромосомные генетические элементы размером более 90 kb в клетках природных штаммов B. subtilis, изолированных из различных природных источников на территории Беларуси. С использованием вектора pMTL21C были получены мини-репликоны трех плазмид, выделенных из штаммов 19, 57 и 72, и определены их размеры (табл. 1). фракции однонитевой ДНК при репликации мини-репликонов pMTLBS19, pMTLBS57 и pMTLBS72, позволили предположить уникальность организации их репликативного аппарата и принадлежность к новому, еще не описанному семейству плазмид тета-типа. Минирепликоны наследуются в клетках штамма B. subtilis polA, что говорит о независимости их репликации от функции ДНК-полимеразы I, что исключает их сходство с внехромосомными генетическими элементами, инициация репликации которых зависит от функции данного фермента, в частности, с широко распространенными среди грамположительных бактерий плазмидами тета-типа семейства pAM?1. Выяснение молекулярно-генетической организации rep-областей изучаемых плазмид осуществлялось путем секвенирования и функционального анализа делеционных и инсерционных изменений внутри клонированных мини-репликонов. + 1 lacOid operator M13/pUC reverse sequencing primer (-26), 17-mer 5’- AA TTG TGA GCG GAT AAC AAT TTC ACA CAG GAA ACA GCT ATG ACC ATG ATT ACG CCA AGC TTG CAT GCC TGC AGG CCT CGA GAT CTC M T M I T P S L H A C R P R D L M13/pUC sequencing primer (-20), 17-mer CAT GGA CGC GTG ACG TCG ACT CTA GAG GAT CCC CGG GTA CCG AGC TCG AAT TCA CTG GCC GTC GTT TTA CAA CGT CGT GAC TGG GA – 3’ H G R V T S T L E D P R V P S S N S L A V V L > LacZ Рис. 1. Организация мини-репликонов плазмид pBS72 (3081 bp), pBS57 (2892 bp) и pBS4 (2076 bp). Обозначения: промотор, последовательность Шайн-Дальгарно, терминатор; повторы ( – правая, – левая ориентация); DnaA связывающие последовательности ( ). Открытые рамки считывания (orf - 1-4) детерминируют синтез полипептидов, состоящих из 344, 168, 113, 87 аминокислотных остатков, соответственно. Для репликации плазмид необходимы ген repA и область, содержащая в своем составе ориджин вегетативной репликации - oriV. В пределах секвенированных последовательностей обнаружено несколько открытых рамок считывания. Анализ первичной структуры белков, предположительно детерминируемых orf - 2 и orf - 3, не позволил выявить гомологии с известными. Однако достоверное сходство было обнаружено для полипептида, детерминируемого неполной открытой рамкой считывания orf - 4 с С-терминальной областью бактериальных белков из семейства ParA/Soj, обеспечивающих распределение дочерних молекул ДНК в процессе клеточного деления. Кроме того, для фрагмента полипептида, кодируемого открытой рамкой считывания orf – 1, установлена гомология с N-терминальной последовательностью белка DnaA некоторых грамположительных и грамотрицательных бактерий, участвующего в инициации репликации хромосомы (рис. 2). RepA 263 MTTEEEKVDSTLKSEMQNRVSKPSFDTWFKNTKI-KIENKNCL-LLV--PSEFAFEWIKKRYLETIKTVLEEA-GYVFE 336 M EE +TLK +++ ++SKPSF+TW K+TK -+ K+ L-++ --P+EFA +W++ RYL I +L E 1 (13-68) AQIEKKLSKPSFETWMKSTKA-HSLQGDTLTITA--PNEFARDWLESRYLHLIADTIYE 2 (14-63) QIEKKLSKPSFETWMKSTKA-HSLQGDTLIITA--PNEFARDWLESRYLHLI 3 (9-66) NSALK-ELEKKVSKPSYETWLKSTTA-HNLKKDVLTITA--PNEFARDWLESHYSELISETL 4 (14-69) EMKKKVSKPSYETWLRATKA-NALQNNDT-IIVTAPNEFARDWLEDHYSGLTSDIIEQ 5 (3-68) EQEIWEKVLTLAQEKVSSASYQTFLKDTKLFKLQNEQAI-VVT—DDDFVANWLKMNYAEIIKAALYEA 6 (3-74) EQEIWKKVLEVAESEISKSTFNTFLKDTELKEIRDNVAI-IFV--IHEFYAEWLNSNYKEVIQTIMKDVIGYEVE 7 (2-71) SEKEIWDKVLEIA-QERISNTSYQTFIKDTQLYSLKNDEAI-ILV--SLPFNASWLNQRYSEIMQAIIYDVIGY 8 (13-74) EEELSAQQFNTWIKPLRF-EAREGTLR-LLA--PNRFVQQWVKDRFLQKISALAEEV—LSTPVQIEL 9 (2-71) SEKEIWDKVLEIA-QERISNTSYQTFIKDTQLYSLKNDEAI-ILV--SLPFNASWLNQRYSEIMQAIIYDVIGY 10 (12-65) QLQEELPATEFSMWVRPLQA-ELNDNTLT-LFA--PNRFVLDWVRDKYLNSINRLLQE 11 (13-65) LQEELPSAEFSMWVRPLQA-ELNDNTLT-LFA--PNRFVLDWVRDKYLNSINSLLNE 12 (13-67) LRDELPAQQFNTWIRPLQV-EAEGDELR-VYA--PNRFVLDWVNEKYLGRVLELLDEH-G 13 (13-67) LRDELPSQQFNTWIRPLQV-EAEGDELR-VYA--PNRFVLDWVNEKYLGRLLELLGER-G 14 (1-68) MENIEELWSATLK-KIEEKLSKPSFDTWLKNTKA-EALEKDTL-IIS-APNEFARDWLENQYTNLISQMLLE 15 (9-68) ERALKS-MEKKVSKPSFETWLKQTKA-NSIEDSTI-IIT-APNEFARDWLEKHYDELISETIDD 16 (11-72) VQKSLQKTLSKPSFETWIRPAKF-NCFENGLL-TLI-APNTFSSDWLRKNYCETIEKTAKEICGY 17 (15-69) SKLENELSKPSFETWLSSTYL-LDIEGDTL-IVSV-PNEFAKDWLESRYAPIIRSTVQ 18 (13-72) AEIEQKISKPSFETWLKSTKA-HSLRGDTL-VIV-APNEFARDWLDSRYSHLIAETIYTITGE 19 (16-76) LQLQLSKPTFETWIKTATA-EQLENNCL-VIR-APNPFARNWLQKYYIKTIADVVHDILGYPVE 20 (11-69) SQVLERLQIELSRPTFETWIKTANA-ERLENNCL-VII-TPNPFARNWLQKYYISTIANVVQ 21 (10-68) SQVLERLQIELSRPTFETWIKTANA-ERLENNCL-VII-TPNPFARNWLQKYYITTIANVVQ   Figure 2: Sequence analysis of the С-terminal region of RepA (pBS72) with N-terminal domain of the DnaA protein of some Gram-positive and Gram-negative bacteria: 1 – DnaA B. subtilis subsp. subtilis str. 168 (the level of identity, similarity and the E-value are 35%, 63%, and 1*10-5, respectively); 2 – DnaA B. licheniformis DSM13; 3 - DnaA B. anthracis; B. thuringiensis serovar konkukian str. 97-27, B. cereus E33L; 4 - DnaA B. clausii KSM-K16; 5 - DnaA Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305; 6 - DnaA Staphylococcus haemolyticus JCSC1435; 7 - DnaA Staphylococcus epidermidis ATCC 12228; 8 - DnaA Methylobacillus flagellatus KT; 9 – DnaA Haemophilus parasuis;10 - DnaA Vibrio harveyi; 11 - DnaA Vibrio fischeri ES114;12 - DnaA Pseudomonas fluorescens Pf-5;13 - DnaA Pseudomonas aeruginosa PAO1;14 – DnaA Oceanobacillus iheyensis;15 – DnaA B. halodurans C-125 (the level of identity, similarity and the E-value are 42%, 64%, and 9*10-9, respectively); 16 - DnaA Prochlorococcus marinus str. MIT 9312;17 - DnaA Desulfitobacterium hafniense DCB-2;18 – DnaA Geobacillus kaustophilus HTA426; 19 - DnaA Trichodesmium erythraeum IMS101; 20 – DnaA Nostoc sp. PCC 7120; 21 - DnaA Anabaena variabilis ATCC 29413. Обсуждая выявленную гомологию белка, детерминируемого открытой рамкой считывания 1, с DnaА-белком хромосомного происхождения, хотелось бы отметить следующее. Для инициации репликации бактериальной хромосомы (в частности E. coli) на первом этапе происходит олигомеризация белка DnaA, который затем взаимодействует с областью oriC, обеспечивая локальное расплетение двунитевой ДНK в данном участке, тем самым обуславливая присоединение хеликазы. Эти процессы определяются N-терминальной последовательностью DnaA-белка. Возможно, что сходство организации первичной структуры C-терминальной последовательности RepA-белка с N-терминальной последовательностью DnaA-белка позволяет белку RepA выполнять аналогичные функции при инициации репликации плазмиды. Для остальной части белка, кодируемого orf - 1, гомологии с известными белками из банка данных выявлено не было, однако было показано, что в области между 111 и 132 аминокислотными остатками локализована ДНК-связывающая последовательность (НТН-сайт). Приведенные факты свидетельствуют в пользу того, что полипептидов, подобных обнаруженному, ранее описано не было. На этом основании можно предположить, что продукт, детерминируемый открытой рамкой считывания orf - 1, является новым Rep-белком, стимулирующим инициацию репликации плазмиды pBS72. Последовательность протяженностью в 370 п.н., располагающаяся между открытыми рамками считывания 1 и 2, включает типичный DnaA-связывающий сайт (ТТА ТСС АСА), а также четыре прямых и один инвертированный повторы, имеющие сходные нуклеотидные последовательности (АТТ ААА Т(Т/А) ТТ (А/G) A(T/C)), которые могут являться потенциальными сайтами связывания с белком, инициирующим репликацию. Кроме того, у 3'-конца второй открытой рамки считывания orf - 2 расположен еще один типичный DnaA-связывающий сайт. Выявленные закономерности позволяют предполагать, что анализируемая область представляет собой сайт начала вегетативной репликации (oriV) плазмиды pBS72 (рис. 1). Отсутствие гомологии с охарактеризованными плазмидами RCR-типа и тета–типа позволяет заключить, что клонированный репликон представляет собой новый класс репликонов. Результаты полимеразной цепной реакции rep-областей плазмид размером более 90 kb с последующим рестрикционным и сиквенс-анализом продуктов амплификации позволили продемонстрировать сходство их организации и отнести данные внехромосомные генетические элементы к новой систематической группе, включающей как минимум десять представителей, выявленных среди природных штаммов бактерий B. subtilis, выделенных на территории Беларуси. Результаты, полученные в ходе секвенирования и функционального анализа мини-репликона плазмиды тета-типа pBS72, изолированной из природного штамма B.subtilis, позволили изолировать их базовый репликон, пригодный для создания векторных молекул. Для его поддержания в клетках B.subtilis необходимо только наличие rep-гена и ориджина вегетативной репликации. Это послужило основанием для создания серии двурепликонных векторов на основе репликона плазмиды тета-типа pBS72 и плазмиды pMTL21C (рис. 4). В качестве базовой конструкции, обеспечивающей поддержание векторных молекул в клетках E. coli, использовали многокопийную плазмиду pMTL21C, несущую ColEI-репликон, ген ампициллинрезистентности (Amp), выражающийся в E. coli, и ген устойчивости к хлорамфениколу (Cm), экспрессирующийся в бактериях B. subtilis, а также полилинкер, включенный в ген lacZ?. Наличие полилинкера, содержащего 21 уникальный сайт, позволяет клонировать фрагменты ДНК, вызывая при этом инактивацию гена lacZ?, выявляемую по формированию неокрашенных колоний на селективной среде, содержащей IPTG и Х-Gal. Кроме того, в составе плазмиды pMTL21C содержится несколько уникальных сайтов (в частности, AflII-сайт), которые не затрагивают ни одну из указанных выше функциональных единиц и могут быть использованы для клонирования rep-области плазмиды pBS72. Путем клонирования продукта амплификации rep-области плазмиды pBS72 в сайт AflII вектора pMTL21C были получены конструкции pMTL7-1, pMTL7-2 и pAL1. Полученные конструкции являются векторами общего назначения и пригодны для клонирования и секвенирования генетического материала. При этом экспрессия встроенных фрагментов ДНК в составе данных векторных молекул осуществляется с tac-промотора, индуцируемого в клетках E. coli и способного обеспечить базовый уровень экспрессии в клетках B. subtilis. Рис. 4. Молекулярно-генетическая организация векторов общего назначения. На рисунке указана локализация сайтов рестрикции и детерминант: oriEc – ColE1-репликон, обеспечивает наследование в клетках E. coli; oriV и Rep – rep-область плазмиды pBs72, обеспечивает наследование репликона в клетках B. subtilis; MCS - полилинкер размером 78 bp, несущий 16 сайтов, пригодных для молекулярного клонирования, фланкирован праймерами M13/pUC, расположен в N-терминальной последовательности гена lacZ?; маркеры устойчивости к ампициллину (Amp) и хлорамфениколу (Cm), выражающиеся в бактериях E. coli и B. subtilis, соответственно. tac- region References Anagnostopoulos C., Spizizen J. // J. Bacteriol. – 1961. – Vol. 81, № 5. - P. 741–746. Birnboim H. L. Doly J. // Nucl. Acids. Res. – 1979. – Vol. 7, № 6. – P. 1513–1523. Bron S. Plasmids // Molecular Biological Methods for Bacillus. Ed. Harwood C.R. - John Wiley and Sons Ltd, Chichester. – 1990. – p. 75–174. Kozlovskiy Yu.E., Prozorov A.A. // Reports of AS USSR. – 1981. – Vol 258, № 6. – P. 1457–1459 (in Russian). Lagodich A.V., Cherva E.A., Shtaniuk Ya.V., Prokulevich V.A., Fomichev Yu.K., Prozorov A.A., Titok M.A. // Molecular Biology. –2005. – Vol. 39, № 2. – P. 306–309. Lagodich A.V., Shtaniuk Ya.V., Prozorov A.A., Titok M.A. // Molecular Biology. – 2004. – Vol. 38, № 3. – P. 366–369. Sambrook J., Fritsch E., Maniatis T. Molecular cloning: a laboratory manual. 2nd ed./Cold Spring Harbor Laboratory, Cold Spring Harbor Publications, NY.- 1989.-468 P. Titok M.A., Chapuis J., Selezneva Y.V., Lagodich A.V., Prokulevich V.A., Ehrlich S.D., Janniere L. // Plasmid. – 2003. – Vol. 49, № 1. – P. 53–62. Заключение Система бирепликонных векторов была создана на базе репликона новой плазмиды тета-типа pBS72 и репликона плазмиды pBR322. Данные вектора эффективно трансформируют клетки E. coli и B. subtilis (106 и 105 клеток на 1 мкг ДНК), структурно и сегрегационно стабильны, однако копийность указанных векторов в клетках B. subtilis не велика (5-6 копий). С использованием химического мутагенеза удалось получить варианты, демонстрирующие устойчивость к повышенным концентрациям антибиотика. Нами было показано, что ориентация клонированной rep-области не оказывает влияния на способность плазмиды наследоваться в клетках E. coli и B. subtilis. В следующей серии экспериментов было установлено, что эффективность трансформации клеток E. coli и B. subtilis препаратами плазмидной ДНК составляет 106 и 105 клеток на 1?g ДНК, соответственно. Созданный вектор в равной степени пригоден для клонирования в системах E. coli и B. subtilis. При этом число плазмидных копий в реципиентных бактериях E. coli соответствует ColEI-репликону, а в бактериях B. subtilis - репликону рBS72 (5-6 копий). Полученный вектор характеризуются высокой емкостью (до 10 kb) и выраженной структурной и сегрегационной стабильностью в клетках бактериальных хозяев E. coli и B. subtilis. Для созданной конструкции известна полная нуклеотидная последовательность ДНК, что позволяет осуществлять с ней различного рода манипуляции, в том числе создавать новые векторные молекулы (например, векторы специального назначения), что и было предпринято в дальнейшем. Варианты с измененным числом копий могут служить основой для конструирования векторных систем, а также для изучения тонких механизмов репликации и сегрегации. Для изменения числа копий мини-репликона плазмиды pBS72, детерминирующего устойчивость к хлорамфениколу в концентрации 5 мкг/мл использовали химический мутагенез in vitro (гидроксиламин). Мутантные конструкции были отобраны путем прямой селекции трансформантов  B. subtilis 168 trpС2 на средах с повышенной концентрацией хлрамфеникола (50 мкг/мл). Мутационные изменения, приводящие к увеличению числа копий плазмидного репликона, были картированы путем секвенирования. На основании анализа электрофореграмм было установлено увеличение отношения фракций плазмидной ДНК к хромосомной от 2 до 10 раз по сравнению с исходным вариантом, что свидетельствовало об увеличении числа копий исследуемых мутантов. Мутации были выявлены в области dnaA-бокса, oriV-сайте и repA-гене. В последовательности dnaA-бокса, примыкающего к сайту oriV, обнаружены три точечные делеционные мутации, причем одна из них, присутствовала во всех проанализированных вариантах. В области oriV достаточно часто обнаруживалась замена аденина на гуанин в последовательности инвертированного повтора (обнаружена у пяти из семи проанализированных мутантов). В пределах repA-гена выявлены трансверсии и транзиции, приводящие к изменению в области домена полипептидной цепи RepA, предположительно обладающего ДНК-связывающей активностью, а также транзиции в области характерной для доменов с АТФ-азной активностью. Подобно исходному мини-репликону плазмиды pBS72 все исследованные мутантные варианты характеризовались стабильностью наследования в клетках типового штамма B. subtilis 168 trpС2 и утрачивались с частотой более 90% из бактерий B. subtilis L1432, несущих мутацию гена dnaB19. Исключение составил вариант, содержащий транзицию в области инвертированного повтора oriV сайта и делецию последовательности dnaA-бокса (стабильность наследования увеличилась в 10 раз). Исходя из возможных фукций белка DnaB, можно предположить, что изменение в области инициации репликации приводит не только к изменению числа копий, но также влияет на процессы распределения дочерних молекул плазмидной ДНК в процессе деления. Полученные мини-репликоны эффективно трансформировали клетки типового штамма B. subtilis 168 trpC2 и стабильно наследовались в ряду поколений (вероятность утраты составляла 4-6% на 60 генераций). Гибридизация по Саузерну позволила заключить, что изучаемые плазмиды имеют сходные rep-области, и не принадлежат ни к одному из известных семейств плазмид грамположительных бактерий, в частности pAM?1, рТВ19, pLS20 (плазмиды ?-типа) и pT181, pE194, pC194 (плазмиды RCR-типа). Размер исходных плазмид, а также отсутствие Рис. 3. Результаты функционального анализа rep-области плазмиды pBS72 бактерий B. subtilis бактерий B. subtilis. Делеционные (варианты рМАТ2 – рМАТ11) и инсерционные (варианты рМАТ12 – рМАТ14) мутанты были изолированы в бактериях E. coli и проанализированы на способность реплицироваться в бактериях B. subtilis: ?+? – трансформирующая активность и стабильность наследования соответствует исходному варианту (вариантp рMTLBS72); ?+/-? – трансформирующая активность и стабильность наследования на порядок ниже чем у исходного варианта; ?-? – мутантные плазмиды не трансформируют бактерии B. subtilis, - – места инсерций. Минимальный репликон плазмиды pBS72 соответствует варианту рМАТ11. Рис. 5. Локализация мутаций в пределах rep-области плазмиды pBS72. Обозначения мутаций: инсерции (?), делеции (?), транзиции и трансверсии (?). У всех мутантов были обнаружены изменения в терминальной области orf2. Поскольку в использованном мини-репликоне orf2 является неполной, а одна из делеций характерна для всех охарактеризованных мутантов, то возникшие изменения копийности могут быть связаны в т.ч. с функцией dnaA-бокса, локализованного в пределах orf2, и примыкающих к нему областей. Интересно, что одна из транзиций mut7 затрагивает центральный район инвертированного повтора области oriV (ttaaAatttaat > ttaaGatttaat), и может изменять его предполагаемую функцию мишени для посадки регуляторной молекулы. Помимо описанных выше мутаций у mut4 в пределах repA-гена выявлена трансверсия G>T в позиции 286, приводящая к замене A>S (97) в области ДНК-связывающего домена полипептидной цепи RepA, а у mut7 - 4 транзиции A>G в позициях 82, 85, 152, 607, приводящие к аминокислотным заменам K>E (28), R>G (29), E>G (51) того же домена RepA, и в области домена, ответственного за АТФ-азную активность - N>D (223). У mut5 выявлена инсерция С между старт-кодоном repA-гена и последовательностью Шайн-Дальгарно (RBS): 5’- gatcgcggagggCacattATG –3’, что может изменить уровень экспрессии repA-гена и, как следствие, концентрацию RepA в клетке. На следующем этапе работы были осуществлены эксперименты по установлении связи между типом мутационного изменения и его фенотипическим проявлением, детектируемым по уровню устойчивости к антибиотику, данные представлены на (рис 5).


×

HTML:





Ссылка: